SCOPe 2.04: Domain d4gitb_: 4git B:

Lineage for d4gitb_ (4git B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein ATPase domain of protease Lon (La) [102393] (2 species)

7. Species Brevibacillus thermoruber [TaxId:33942] [227843] (1 PDB entry)

8. Domain d4gitb_: 4git B: [227845]
   automated match to d1qzma_
   complexed with so4

Details for d4gitb_

PDB Entry: 4git, 2.88 Å

PDB Description: Crystal structure of alpha sub-domain of Lon protease from Brevibacillus thermoruber

PDB Compounds: (B:) Lon protease

SCOPe Domain Sequences for d4gitb_:

Sequence; same for both SEQRES and ATOM records:

>d4gitb_ c.37.1.20 (B:) ATPase domain of protease Lon (La) {Brevibacillus thermoruber [TaxId: 33942]}
gyteleklhimrdyllpkqmeehglgrdklqmneeamlkvirqytreagvrnlnreaani
crkaarlivsgekkrvvvtpktvesllgkpry

Timeline for d4gitb_:

• d4gitb_ first appeared in SCOPe 2.03
  
• d4gitb_ appears in SCOPe 2.05
  
• d4gitb_ appears in the current release, SCOPe 2.08