Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Burkholderia graminis [TaxId:396598] [227808] (2 PDB entries) |
Domain d4mf6a2: 4mf6 A:104-234 [227809] Other proteins in same PDB: d4mf6a1, d4mf6a3 automated match to d4ikha2 complexed with bez, gsh |
PDB Entry: 4mf6 (more details), 1.2 Å
SCOPe Domain Sequences for d4mf6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf6a2 a.45.1.0 (A:104-234) automated matches {Burkholderia graminis [TaxId: 396598]} lipqdaagryeaiqwvmfqmggigpmfgqlgffhkfagkeyedkrprdryvaeskrllgv leqrlegrewilgdqysiadiatfpwvrnligfyeagelvaiqdfpnvqralaafvarpa vvrgldspkrg
Timeline for d4mf6a2: