SCOPe 2.07: Domain d4mf6a2: 4mf6 A:104-234

Lineage for d4mf6a2 (4mf6 A:104-234)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Burkholderia graminis [TaxId:396598] [227808] (2 PDB entries)

8. Domain d4mf6a2: 4mf6 A:104-234 [227809]
   Other proteins in same PDB: d4mf6a1, d4mf6a3
   automated match to d4ikha2
   complexed with bez, gsh

Details for d4mf6a2

PDB Entry: 4mf6, 1.2 Å

PDB Description: Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit

PDB Compounds: (A:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4mf6a2:

Sequence; same for both SEQRES and ATOM records:

>d4mf6a2 a.45.1.0 (A:104-234) automated matches {Burkholderia graminis [TaxId: 396598]}
lipqdaagryeaiqwvmfqmggigpmfgqlgffhkfagkeyedkrprdryvaeskrllgv
leqrlegrewilgdqysiadiatfpwvrnligfyeagelvaiqdfpnvqralaafvarpa
vvrgldspkrg

Timeline for d4mf6a2:

• d4mf6a2 first appeared in SCOPe 2.03
  
• d4mf6a2 appears in SCOPe 2.06
  
• d4mf6a2 appears in the current release, SCOPe 2.08