Lineage for d4mf6a2 (4mf6 A:104-234)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713888Species Burkholderia graminis [TaxId:396598] [227808] (2 PDB entries)
  8. 2713890Domain d4mf6a2: 4mf6 A:104-234 [227809]
    Other proteins in same PDB: d4mf6a1, d4mf6a3
    automated match to d4ikha2
    complexed with bez, gsh

Details for d4mf6a2

PDB Entry: 4mf6 (more details), 1.2 Å

PDB Description: Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with two glutathione molecules bound per one protein subunit
PDB Compounds: (A:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4mf6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mf6a2 a.45.1.0 (A:104-234) automated matches {Burkholderia graminis [TaxId: 396598]}
lipqdaagryeaiqwvmfqmggigpmfgqlgffhkfagkeyedkrprdryvaeskrllgv
leqrlegrewilgdqysiadiatfpwvrnligfyeagelvaiqdfpnvqralaafvarpa
vvrgldspkrg

SCOPe Domain Coordinates for d4mf6a2:

Click to download the PDB-style file with coordinates for d4mf6a2.
(The format of our PDB-style files is described here.)

Timeline for d4mf6a2: