| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (7 PDB entries) |
| Domain d4m49c1: 4m49 C:1-159 [227781] Other proteins in same PDB: d4m49a2, d4m49b2, d4m49c2, d4m49d2 automated match to d1i10a1 complexed with 22y, epe, lac, nai, so4 |
PDB Entry: 4m49 (more details), 2.05 Å
SCOPe Domain Sequences for d4m49c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m49c1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4m49c1: