Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries) |
Domain d4jvze_: 4jvz E: [227739] automated match to d2qw7a1 complexed with so4 |
PDB Entry: 4jvz (more details), 2.01 Å
SCOPe Domain Sequences for d4jvze_:
Sequence, based on SEQRES records: (download)
>d4jvze_ b.40.15.1 (E:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]} mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg saarhiingtdkpidaavvaiidtvsrdnyllysk
>d4jvze_ b.40.15.1 (E:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]} mkiarvcgtvtstqkedtltgvkflvlqylgeflpdyevaadtvgagqdewvlvsrgsaa rhiingtdkpidaavvaiidtvsrdnyllysk
Timeline for d4jvze_:
View in 3D Domains from other chains: (mouse over for more information) d4jvza_, d4jvzb_, d4jvzc_, d4jvzd_ |