SCOPe 2.07: Domain d4jvze_: 4jvz E:

Lineage for d4jvze_ (4jvz E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (2 families)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
   Pfam PF03319

6. Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (3 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [227737] (2 PDB entries)

8. Domain d4jvze_: 4jvz E: [227739]
   automated match to d2qw7a1
   complexed with so4

Details for d4jvze_

PDB Entry: 4jvz, 2.01 Å

PDB Description: Structure of Thermosynechococcus elongatus CcmL

PDB Compounds: (E:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4jvze_:

Sequence, based on SEQRES records:

>d4jvze_ b.40.15.1 (E:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylgedgeflpdyevaadtvgagqdewvlvsrg
saarhiingtdkpidaavvaiidtvsrdnyllysk

Sequence, based on observed residues (ATOM records):

>d4jvze_ b.40.15.1 (E:) Carbon dioxide concentrating mechanism protein CcmL {Thermosynechococcus elongatus [TaxId: 197221]}
mkiarvcgtvtstqkedtltgvkflvlqylgeflpdyevaadtvgagqdewvlvsrgsaa
rhiingtdkpidaavvaiidtvsrdnyllysk

Timeline for d4jvze_:

• d4jvze_ first appeared in SCOPe 2.03
  
• d4jvze_ appears in SCOPe 2.06
  
• d4jvze_ appears in the current release, SCOPe 2.08