SCOPe 2.06: Domain d4bex1_: 4bex 1:

Lineage for d4bex1_ (4bex 1:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)

8. Domain d4bex1_: 4bex 1: [227616]
   automated match to d1q8xa_

Details for d4bex1_

PDB Entry: 4bex, 2.8 Å

PDB Description: Structure of human Cofilin1

PDB Compounds: (1:) cofilin-1

SCOPe Domain Sequences for d4bex1_:

Sequence; same for both SEQRES and ATOM records:

>d4bex1_ d.109.1.2 (1:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkltgikhelqancyeevkdratlaeklggsavislegkpl

Timeline for d4bex1_:

• d4bex1_ first appeared in SCOPe 2.03
  
• d4bex1_ appears in SCOPe 2.05
  
• d4bex1_ appears in SCOPe 2.07
  
• d4bex1_ appears in the current release, SCOPe 2.08