![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein automated matches [190045] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries) |
![]() | Domain d4bex1_: 4bex 1: [227616] automated match to d1q8xa_ |
PDB Entry: 4bex (more details), 2.8 Å
SCOPe Domain Sequences for d4bex1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bex1_ d.109.1.2 (1:) automated matches {Human (Homo sapiens) [TaxId: 9606]} masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass kdaikkkltgikhelqancyeevkdratlaeklggsavislegkpl
Timeline for d4bex1_: