Lineage for d4bex1_ (4bex 1:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534399Protein automated matches [190045] (5 species)
    not a true protein
  7. 2534409Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries)
  8. 2534414Domain d4bex1_: 4bex 1: [227616]
    automated match to d1q8xa_

Details for d4bex1_

PDB Entry: 4bex (more details), 2.8 Å

PDB Description: Structure of human Cofilin1
PDB Compounds: (1:) cofilin-1

SCOPe Domain Sequences for d4bex1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bex1_ d.109.1.2 (1:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
masgvavsdgvikvfndmkvrksstpeevkkrkkavlfclsedkkniileegkeilvgdv
gqtvddpyatfvkmlpdkdcryalydatyetkeskkedlvfifwapesaplkskmiyass
kdaikkkltgikhelqancyeevkdratlaeklggsavislegkpl

SCOPe Domain Coordinates for d4bex1_:

Click to download the PDB-style file with coordinates for d4bex1_.
(The format of our PDB-style files is described here.)

Timeline for d4bex1_: