Lineage for d4kdoa_ (4kdo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778345Domain d4kdoa_: 4kdo A: [227560]
    Other proteins in same PDB: d4kdob_, d4kdod_, d4kdof_
    automated match to d4kpsa_
    complexed with nag, sia

Details for d4kdoa_

PDB Entry: 4kdo (more details), 2.4 Å

PDB Description: Crystal structure of the hemagglutinin of ferret-transmissible H5N1 virus in complex with human receptor analog LSTc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kdoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdoa_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdoa_:

Click to download the PDB-style file with coordinates for d4kdoa_.
(The format of our PDB-style files is described here.)

Timeline for d4kdoa_: