PDB entry 4kdo

View 4kdo on RCSB PDB site
Description: Crystal structure of the hemagglutinin of ferret-transmissible H5N1 virus in complex with human receptor analog LSTc
Class: viral protein
Keywords: homotrimer, virus attachment and membrane fusion, VIRAL PROTEIN
Deposited on 2013-04-25, released 2013-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (1-321)
      • expression tag (0)
      • engineered mutation (154)
      • engineered mutation (220)
      • engineered mutation (222)
      • engineered mutation (315)
    Domains in SCOPe 2.05: d4kdoa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kdob_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (1-321)
      • expression tag (0)
      • engineered mutation (154)
      • engineered mutation (220)
      • engineered mutation (222)
      • engineered mutation (315)
    Domains in SCOPe 2.05: d4kdoc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kdod_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (1-321)
      • expression tag (0)
      • engineered mutation (154)
      • engineered mutation (220)
      • engineered mutation (222)
      • engineered mutation (315)
    Domains in SCOPe 2.05: d4kdoe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4kdof_
  • Heterogens: SIA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoA (A:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlaiglrnsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoC (C:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlaiglrnsp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoD (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoE (E:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlaiglrnsp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kdoF (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeisg