Lineage for d4kdoa1 (4kdo A:5-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040552Domain d4kdoa1: 4kdo A:5-325 [227560]
    Other proteins in same PDB: d4kdoa2, d4kdob_, d4kdoc2, d4kdod_, d4kdoe2, d4kdof_
    automated match to d4kpsa_
    complexed with nag, sia

Details for d4kdoa1

PDB Entry: 4kdo (more details), 2.4 Å

PDB Description: Crystal structure of the hemagglutinin of ferret-transmissible H5N1 virus in complex with human receptor analog LSTc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdoa1 b.19.1.2 (A:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdoa1:

Click to download the PDB-style file with coordinates for d4kdoa1.
(The format of our PDB-style files is described here.)

Timeline for d4kdoa1: