Lineage for d4jtoa_ (4jto A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558815Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 1558816Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 1558822Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (21 PDB entries)
  8. 1558839Domain d4jtoa_: 4jto A: [227496]
    automated match to d3elna_
    complexed with cys, fe2

Details for d4jtoa_

PDB Entry: 4jto (more details), 2 Å

PDB Description: Cysteine bound Cysteine Dioxygenase at pH 8.0 in the presence of Cys and dithionite
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d4jtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtoa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d4jtoa_:

Click to download the PDB-style file with coordinates for d4jtoa_.
(The format of our PDB-style files is described here.)

Timeline for d4jtoa_: