Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein Cysteine dioxygenase type I [141616] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (21 PDB entries) |
Domain d4jtoa_: 4jto A: [227496] automated match to d3elna_ complexed with cys, fe2 |
PDB Entry: 4jto (more details), 2 Å
SCOPe Domain Sequences for d4jtoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jtoa_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]} ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk fgirtp
Timeline for d4jtoa_: