SCOP 1.57: Domain d1dlqa_: 1dlq A:

Lineage for d1dlqa_ (1dlq A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)

6. Protein Catechol 1,2-dioxygenase [49484] (1 species)

7. Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)

8. Domain d1dlqa_: 1dlq A: [22639]

Details for d1dlqa_

PDB Entry: 1dlq, 2.3 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 inhibited by bound mercury

SCOP Domain Sequences for d1dlqa_:

Sequence; same for both SEQRES and ATOM records:

>d1dlqa_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

Timeline for d1dlqa_:

• d1dlqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dlqa_ appears in SCOP 1.59
  
• d1dlqa_ appears in the current release, SCOPe 2.08