Lineage for d1dlqa_ (1dlq A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10679Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 10680Family b.3.6.1: Aromatic compound dioxygenase [49483] (3 proteins)
  6. 10681Protein Catechol 1,2-dioxygenase [49484] (1 species)
  7. 10682Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 10689Domain d1dlqa_: 1dlq A: [22639]

Details for d1dlqa_

PDB Entry: 1dlq (more details), 2.3 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 inhibited by bound mercury

SCOP Domain Sequences for d1dlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlqa_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOP Domain Coordinates for d1dlqa_:

Click to download the PDB-style file with coordinates for d1dlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1dlqa_: