Lineage for d1dlqa_ (1dlq A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. Protein Catechol 1,2-dioxygenase [49484] (1 species)
    contains alpha-helical dimerization subdomain at the N-terminus
  7. Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. Domain d1dlqa_: 1dlq A: [22639]
    complexed with fe, hg, lio

Details for d1dlqa_

PDB Entry: 1dlq (more details), 2.3 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 inhibited by bound mercury
PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d1dlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlqa_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOPe Domain Coordinates for d1dlqa_ are not available.

Timeline for d1dlqa_:

Domains from other chains:
(mouse over for more information)
d1dlqb_