Lineage for d1ciu_2 (1ciu 579-683)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106205Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 106206Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 106216Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 106262Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (2 PDB entries)
  8. 106263Domain d1ciu_2: 1ciu 579-683 [22521]
    Other proteins in same PDB: d1ciu_1, d1ciu_3, d1ciu_4

Details for d1ciu_2

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

SCOP Domain Sequences for d1ciu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciu_2 b.3.1.1 (579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOP Domain Coordinates for d1ciu_2:

Click to download the PDB-style file with coordinates for d1ciu_2.
(The format of our PDB-style files is described here.)

Timeline for d1ciu_2: