Lineage for d1ciua2 (1ciu A:579-683)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768632Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 2768696Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49459] (4 PDB entries)
  8. 2768699Domain d1ciua2: 1ciu A:579-683 [22521]
    Other proteins in same PDB: d1ciua1, d1ciua3, d1ciua4
    complexed with ca

Details for d1ciua2

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciua2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
ltgnqicvrfvvnnastvygenvyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvs
vpagttiqfkfikkngntitweggsnhtytvpssstgtvivnwqq

SCOPe Domain Coordinates for d1ciua2:

Click to download the PDB-style file with coordinates for d1ciua2.
(The format of our PDB-style files is described here.)

Timeline for d1ciua2: