Class b: All beta proteins [48724] (119 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain [49452] (1 family) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (4 PDB entries) |
Domain d1pamb2: 1pam B:583-686 [22516] Other proteins in same PDB: d1pama1, d1pama3, d1pama4, d1pamb1, d1pamb3, d1pamb4 complexed with ca |
PDB Entry: 1pam (more details), 1.8 Å
SCOP Domain Sequences for d1pamb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pamb2 b.3.1.1 (B:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011} tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp
Timeline for d1pamb2:
View in 3D Domains from other chains: (mouse over for more information) d1pama1, d1pama2, d1pama3, d1pama4 |