Lineage for d1pama2 (1pam A:583-686)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113319Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 1113320Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 1113356Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 1113398Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries)
    Uniprot P05618
  8. 1113399Domain d1pama2: 1pam A:583-686 [22515]
    Other proteins in same PDB: d1pama1, d1pama3, d1pama4, d1pamb1, d1pamb3, d1pamb4
    complexed with ca

Details for d1pama2

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1pama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pama2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOPe Domain Coordinates for d1pama2:

Click to download the PDB-style file with coordinates for d1pama2.
(The format of our PDB-style files is described here.)

Timeline for d1pama2: