Lineage for d1pamb1 (1pam B:497-582)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111680Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1111725Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 1111767Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (8 PDB entries)
    Uniprot P05618
  8. 1111769Domain d1pamb1: 1pam B:497-582 [21847]
    Other proteins in same PDB: d1pama2, d1pama3, d1pama4, d1pamb2, d1pamb3, d1pamb4
    complexed with ca

Details for d1pamb1

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase
PDB Compounds: (B:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1pamb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pamb1 b.1.18.2 (B:497-582) Cyclomaltodextrin glycanotransferase, domain D {Bacillus sp., strain 1011 [TaxId: 1409]}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOPe Domain Coordinates for d1pamb1:

Click to download the PDB-style file with coordinates for d1pamb1.
(The format of our PDB-style files is described here.)

Timeline for d1pamb1: