SCOPe 2.03: Domain d4llob_: 4llo B:

Lineage for d4llob_ (4llo B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)

8. Domain d4llob_: 4llo B: [224697]
   automated match to d4hp9a_

Details for d4llob_

PDB Entry: 4llo, 2 Å

PDB Description: Structure of the eag domain-CNBHD complex of the mouse EAG1 channel

PDB Compounds: (B:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4llob_:

Sequence; same for both SEQRES and ATOM records:

>d4llob_ d.110.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tflenivrrsndtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygelt
dkdtvekvrqtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdita
f

Timeline for d4llob_:

• d4llob_ is new in SCOPe 2.03-stable
  
• d4llob_ appears in SCOPe 2.04
  
• d4llob_ appears in the current release, SCOPe 2.08