Lineage for d4llob_ (4llo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970751Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)
  8. 2970756Domain d4llob_: 4llo B: [224697]
    automated match to d4hp9a_

Details for d4llob_

PDB Entry: 4llo (more details), 2 Å

PDB Description: Structure of the eag domain-CNBHD complex of the mouse EAG1 channel
PDB Compounds: (B:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4llob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llob_ d.110.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tflenivrrsndtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygelt
dkdtvekvrqtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsdita
f

SCOPe Domain Coordinates for d4llob_:

Click to download the PDB-style file with coordinates for d4llob_.
(The format of our PDB-style files is described here.)

Timeline for d4llob_: