Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82796] (44 PDB entries) Uniprot P00533 702-1018 |
Domain d4li5a_: 4li5 A: [224685] automated match to d2eb2a_ complexed with 1wy, na |
PDB Entry: 4li5 (more details), 2.64 Å
SCOPe Domain Sequences for d4li5a_:
Sequence, based on SEQRES records: (download)
>d4li5a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp tdsnfyralmdeedmddvvdadeylipq
>d4li5a_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdeddvvdad eylipq
Timeline for d4li5a_: