SCOPe 2.06: Domain d1cmoa_: 1cmo A:

Lineage for d1cmoa_ (1cmo A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)

8. Domain d1cmoa_: 1cmo A: [22462]

Details for d1cmoa_

PDB Entry: 1cmo

PDB Description: immunoglobulin motif dna-recognition and heterodimerization for the pebp2/cbf runt-domain

PDB Compounds: (A:) polyomavirus enhancer binding protein 2

SCOPe Domain Sequences for d1cmoa_:

Sequence; same for both SEQRES and ATOM records:

>d1cmoa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
vevladhpgelvrtdspnflcsvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagnde
nysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
gpreprr

Timeline for d1cmoa_:

• d1cmoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmoa_ appears in SCOPe 2.05
  
• d1cmoa_ appears in SCOPe 2.07
  
• d1cmoa_ appears in the current release, SCOPe 2.08