![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.6: RUNT domain [81318] (2 proteins) automatically mapped to Pfam PF00853 |
![]() | Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species) synonym: core binding factor alpha, cbfa |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries) |
![]() | Domain d1cmoa_: 1cmo A: [22462] |
PDB Entry: 1cmo (more details)
SCOPe Domain Sequences for d1cmoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmoa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]} vevladhpgelvrtdspnflcsvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagnde nysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd gpreprr
Timeline for d1cmoa_: