Lineage for d1cmoa_ (1cmo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768348Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 2768349Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 2768350Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 2768361Domain d1cmoa_: 1cmo A: [22462]

Details for d1cmoa_

PDB Entry: 1cmo (more details)

PDB Description: immunoglobulin motif dna-recognition and heterodimerization for the pebp2/cbf runt-domain
PDB Compounds: (A:) polyomavirus enhancer binding protein 2

SCOPe Domain Sequences for d1cmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmoa_ b.2.5.6 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
vevladhpgelvrtdspnflcsvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagnde
nysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvd
gpreprr

SCOPe Domain Coordinates for d1cmoa_:

Click to download the PDB-style file with coordinates for d1cmoa_.
(The format of our PDB-style files is described here.)

Timeline for d1cmoa_: