Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries) |
Domain d4kwtb1: 4kwt B:1-152 [224515] Other proteins in same PDB: d4kwta3, d4kwtb3 automated match to d1duvg1 complexed with cl, peg |
PDB Entry: 4kwt (more details), 1.86 Å
SCOPe Domain Sequences for d4kwtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kwtb1 c.78.1.0 (B:1-152) automated matches {Vibrio vulnificus [TaxId: 216895]} mafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekastrt rcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveelga fagvpvwngltdefhptqiladfltmlehsqg
Timeline for d4kwtb1: