SCOPe 2.08: Domain d4kwdc_: 4kwd C:

Lineage for d4kwdc_ (4kwd C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)

6. Protein automated matches [190618] (1 species)
   not a true protein

7. Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)

8. Domain d4kwdc_: 4kwd C: [224511]
   automated match to d2oa6d_
   complexed with gol, jf2, mg, pop

Details for d4kwdc_

PDB Entry: 4kwd, 1.86 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (1R,8R,9aS)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium

PDB Compounds: (C:) Aristolochene synthase

SCOPe Domain Sequences for d4kwdc_:

Sequence; same for both SEQRES and ATOM records:

>d4kwdc_ a.128.1.4 (C:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

Timeline for d4kwdc_:

• d4kwdc_ first appeared in SCOPe 2.03
  
• d4kwdc_ appears in SCOPe 2.07