Lineage for d4kwdb_ (4kwd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337845Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2337860Protein automated matches [190618] (1 species)
    not a true protein
  7. 2337861Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2337863Domain d4kwdb_: 4kwd B: [224510]
    automated match to d2oa6d_
    complexed with gol, jf2, mg, pop

Details for d4kwdb_

PDB Entry: 4kwd (more details), 1.86 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (1R,8R,9aS)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
PDB Compounds: (B:) Aristolochene synthase

SCOPe Domain Sequences for d4kwdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwdb_ a.128.1.4 (B:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

SCOPe Domain Coordinates for d4kwdb_:

Click to download the PDB-style file with coordinates for d4kwdb_.
(The format of our PDB-style files is described here.)

Timeline for d4kwdb_: