SCOPe 2.02: Domain d1edya_: 1edy A:

Lineage for d1edya_ (1edy A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family)

5. Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins)

6. Protein alpha-1-macroglobulin [49412] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry)

8. Domain d1edya_: 1edy A: [22428]

Details for d1edya_

PDB Entry: 1edy, 2.3 Å

PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain

PDB Compounds: (A:) alpha 1-macroglobulin

SCOPe Domain Sequences for d1edya_:

Sequence; same for both SEQRES and ATOM records:

>d1edya_ b.2.4.1 (A:) alpha-1-macroglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapfssds

Timeline for d1edya_:

• d1edya_ first appeared (with stable ids) in SCOP 1.55
  
• d1edya_ appears in SCOPe 2.01
  
• d1edya_ appears in SCOPe 2.03
  
• d1edya_ appears in the current release, SCOPe 2.08