SCOPe 2.08: Domain d1edya_: 1edy A:

Lineage for d1edya_ (1edy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.29: Macroglobulin [254121] (9 families)
   C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations

5. Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
   Pfam PF07677

6. Protein alpha-1-macroglobulin [254335] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [254766] (1 PDB entry)

8. Domain d1edya_: 1edy A: [22428]

Details for d1edya_

PDB Entry: 1edy, 2.3 Å

PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain

PDB Compounds: (A:) alpha 1-macroglobulin

SCOPe Domain Sequences for d1edya_:

Sequence; same for both SEQRES and ATOM records:

>d1edya_ b.1.29.1 (A:) alpha-1-macroglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapfssds

Timeline for d1edya_:

• d1edya_ first appeared (with stable ids) in SCOP 1.55
  
• d1edya_ appears in SCOPe 2.07