SCOPe 2.07: Domain d4k5za_: 4k5z A:

Lineage for d4k5za_ (4k5z A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (13 PDB entries)

8. Domain d4k5za_: 4k5z A: [224170]
   automated match to d1pjpa_
   complexed with 1p7, nag, zn

Details for d4k5za_

PDB Entry: 4k5z, 1.8 Å

PDB Description: crystal structure of human chymase in complex with fragment inhibitor 6-chloro-2,3-dihydro-1h-isoindol-1-one

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k5za_:

Sequence, based on SEQRES records:

>d4k5za_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records):

>d4k5za_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrva
gwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpl
lcagaaqgivsygrsdakppavftrishyqpwinqilqan

Timeline for d4k5za_:

• d4k5za_ first appeared in SCOPe 2.03
  
• d4k5za_ appears in SCOPe 2.06
  
• d4k5za_ appears in the current release, SCOPe 2.08