Lineage for d4k5za_ (4k5z A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056067Protein Chymase (mast cell protease I) [89343] (1 species)
  7. 2056068Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)
  8. 2056074Domain d4k5za_: 4k5z A: [224170]
    automated match to d1pjpa_
    complexed with 1p7, nag, zn

Details for d4k5za_

PDB Entry: 4k5z (more details), 1.8 Å

PDB Description: Crystal Structure of Human Chymase in Complex with Fragment Inhibitor 6-chloro-2,3-dihydro-1H-isoindol-1-one
PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4k5za_:

Sequence, based on SEQRES records: (download)

>d4k5za_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Sequence, based on observed residues (ATOM records): (download)

>d4k5za_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrva
gwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpl
lcagaaqgivsygrsdakppavftrishyqpwinqilqan

SCOPe Domain Coordinates for d4k5za_:

Click to download the PDB-style file with coordinates for d4k5za_.
(The format of our PDB-style files is described here.)

Timeline for d4k5za_: