SCOP 1.65: Domain d1qbb_2: 1qbb 28-200

Lineage for d1qbb_2 (1qbb 28-200)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)

6. Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)

7. Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)

8. Domain d1qbb_2: 1qbb 28-200 [22407]
   Other proteins in same PDB: d1qbb_1, d1qbb_3, d1qbb_4
   complexed with cbs, so4

Details for d1qbb_2

PDB Entry: 1qbb, 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_2:

Sequence; same for both SEQRES and ATOM records:

>d1qbb_2 b.2.2.3 (28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

Timeline for d1qbb_2:

• d1qbb_2 first appeared (with stable ids) in SCOP 1.55
  
• d1qbb_2 appears in SCOP 1.63
  
• d1qbb_2 appears in SCOP 1.67
  
• d1qbb_2 appears in the current release, SCOPe 2.08, called d1qbba2