![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein) |
![]() | Protein Bacterial chitobiase, n-terminal domain [49399] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries) |
![]() | Domain d1qbb_2: 1qbb 28-200 [22407] Other proteins in same PDB: d1qbb_1, d1qbb_3, d1qbb_4 complexed with cbs, so4 |
PDB Entry: 1qbb (more details), 2 Å
SCOP Domain Sequences for d1qbb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbb_2 b.2.2.3 (28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens} dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv
Timeline for d1qbb_2: