Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species) rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases |
Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries) |
Domain d1qbb_1: 1qbb 781-885 [21811] Other proteins in same PDB: d1qbb_2, d1qbb_3, d1qbb_4 complexed with cbs, so4 |
PDB Entry: 1qbb (more details), 2 Å
SCOP Domain Sequences for d1qbb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbb_1 b.1.18.2 (781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens} gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv
Timeline for d1qbb_1: