Lineage for d1qbb_2 (1qbb 28-200)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10334Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 10368Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)
  6. 10369Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)
  7. 10370Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)
  8. 10373Domain d1qbb_2: 1qbb 28-200 [22407]
    Other proteins in same PDB: d1qbb_1, d1qbb_3, d1qbb_4

Details for d1qbb_2

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)

SCOP Domain Sequences for d1qbb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbb_2 b.2.2.3 (28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

SCOP Domain Coordinates for d1qbb_2:

Click to download the PDB-style file with coordinates for d1qbb_2.
(The format of our PDB-style files is described here.)

Timeline for d1qbb_2: