![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Sinorhizobium meliloti [TaxId:266834] [226660] (2 PDB entries) |
![]() | Domain d4jxqa_: 4jxq A: [224061] automated match to d3dr6a_ complexed with 2pe, edo, flc, peg |
PDB Entry: 4jxq (more details), 1.15 Å
SCOPe Domain Sequences for d4jxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jxqa_ d.108.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} mtatlrdavaadlrsiteiyresvlngvatyeetppseaemalrfstitgngypyvvald ergavigyayasafrnrtayrflvedsiylspeargkgigkallselvgrctalgfrqmi aviggahpssialhralgfelqglmkatgfkhgrwldtafmqrplgegtatkptegvypd tlyrs
Timeline for d4jxqa_: