Lineage for d4jqil2 (4jqi L:109-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364238Domain d4jqil2: 4jqi L:109-190 [223941]
    Other proteins in same PDB: d4jqia1, d4jqil1
    automated match to d1rhha2
    complexed with cl, edo, pro

Details for d4jqil2

PDB Entry: 4jqi (more details), 2.6 Å

PDB Description: Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
PDB Compounds: (L:) Fab30 light chain

SCOPe Domain Sequences for d4jqil2:

Sequence, based on SEQRES records: (download)

>d4jqil2 b.1.1.2 (L:109-190) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekh

Sequence, based on observed residues (ATOM records): (download)

>d4jqil2 b.1.1.2 (L:109-190) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvsgnsqesvteqdskdst
yslsstltlskadyekh

SCOPe Domain Coordinates for d4jqil2:

Click to download the PDB-style file with coordinates for d4jqil2.
(The format of our PDB-style files is described here.)

Timeline for d4jqil2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jqil1
View in 3D
Domains from other chains:
(mouse over for more information)
d4jqia1