Lineage for d4jnkc1 (4jnk C:1-159)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579124Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (7 PDB entries)
  8. 1579127Domain d4jnkc1: 4jnk C:1-159 [223915]
    Other proteins in same PDB: d4jnka2, d4jnkb2, d4jnkc2, d4jnkd2
    automated match to d1i10a1
    complexed with epe, lac, nai, so4, zhk

Details for d4jnkc1

PDB Entry: 4jnk (more details), 1.9 Å

PDB Description: Lactate Dehydrogenase A in complex with inhibitor compound 22
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4jnkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnkc1 c.2.1.5 (C:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4jnkc1:

Click to download the PDB-style file with coordinates for d4jnkc1.
(The format of our PDB-style files is described here.)

Timeline for d4jnkc1: