Lineage for d4jhdb2 (4jhd B:147-375)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. 1372746Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (11 PDB entries)
  8. 1372768Domain d4jhdb2: 4jhd B:147-375 [223821]
    Other proteins in same PDB: d4jhda1, d4jhdb1, d4jhdd1, d4jhde1
    automated match to d1d4xa2
    complexed with anp, mg

Details for d4jhdb2

PDB Entry: 4jhd (more details), 2.91 Å

PDB Description: crystal structure of an actin dimer in complex with the actin nucleator cordon-bleu
PDB Compounds: (B:) Actin-5C

SCOPe Domain Sequences for d4jhdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jhdb2 c.55.1.1 (B:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdiredlyantvlsggttmypgiadrmqkeitalakstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

SCOPe Domain Coordinates for d4jhdb2:

Click to download the PDB-style file with coordinates for d4jhdb2.
(The format of our PDB-style files is described here.)

Timeline for d4jhdb2: