Lineage for d4jhdd1 (4jhd D:5-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373421Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (2 PDB entries)
  8. 1373424Domain d4jhdd1: 4jhd D:5-146 [223822]
    Other proteins in same PDB: d4jhda2, d4jhdb2, d4jhdd2, d4jhde2
    automated match to d1d4xa1
    complexed with anp, mg

Details for d4jhdd1

PDB Entry: 4jhd (more details), 2.91 Å

PDB Description: crystal structure of an actin dimer in complex with the actin nucleator cordon-bleu
PDB Compounds: (D:) Actin-5C

SCOPe Domain Sequences for d4jhdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jhdd1 c.55.1.0 (D:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf
etfntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d4jhdd1:

Click to download the PDB-style file with coordinates for d4jhdd1.
(The format of our PDB-style files is described here.)

Timeline for d4jhdd1: