![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (2 PDB entries) |
![]() | Domain d4jhdd1: 4jhd D:5-146 [223822] Other proteins in same PDB: d4jhda2, d4jhdb2, d4jhdd2, d4jhde2 automated match to d1d4xa1 complexed with anp, mg |
PDB Entry: 4jhd (more details), 2.91 Å
SCOPe Domain Sequences for d4jhdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jhdd1 c.55.1.0 (D:5-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimf etfntpamyvaiqavlslyasg
Timeline for d4jhdd1: