SCOPe 2.04: Domain d4jhda2: 4jhd A:147-375

Lineage for d4jhda2 (4jhd A:147-375)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (11 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (11 PDB entries)

8. Domain d4jhda2: 4jhd A:147-375 [223819]
   Other proteins in same PDB: d4jhda1, d4jhdb1, d4jhdd1, d4jhde1
   automated match to d1d4xa2
   complexed with anp, mg

Details for d4jhda2

PDB Entry: 4jhd, 2.91 Å

PDB Description: crystal structure of an actin dimer in complex with the actin nucleator cordon-bleu

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d4jhda2:

Sequence; same for both SEQRES and ATOM records:

>d4jhda2 c.55.1.1 (A:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysfttteer
eivrdikeklcyvaldfeqemataassssleksyelkdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d4jhda2:

• d4jhda2 first appeared in SCOPe 2.03
  
• d4jhda2 appears in SCOPe 2.05
  
• d4jhda2 appears in the current release, SCOPe 2.08