Lineage for d1f00i2 (1f00 I:753-841)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764897Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) (S)
  5. 2764898Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins)
  6. 2764899Protein Intimin [49375] (1 species)
  7. 2764900Species Escherichia coli [TaxId:562] [49376] (5 PDB entries)
    an enteropathogenic serotype
  8. 2764906Domain d1f00i2: 1f00 I:753-841 [22369]
    Other proteins in same PDB: d1f00i3

Details for d1f00i2

PDB Entry: 1f00 (more details), 1.9 Å

PDB Description: crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin
PDB Compounds: (I:) intimin

SCOPe Domain Sequences for d1f00i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f00i2 b.1.14.1 (I:753-841) Intimin {Escherichia coli [TaxId: 562]}
tltiddgnieivgtgvkgklptvwlqygqvnlkasggngkytwrsanpaiasvdassgqv
tlkekgtttisvissdnqtatytiatpns

SCOPe Domain Coordinates for d1f00i2:

Click to download the PDB-style file with coordinates for d1f00i2.
(The format of our PDB-style files is described here.)

Timeline for d1f00i2: