PDB entry 1f00

View 1f00 on RCSB PDB site
Description: crystal structure of c-terminal 282-residue fragment of enteropathogenic e. coli intimin
Class: cell adhesion
Keywords: Immunoglobulin-like fold, C-type lectin-like fold, CELL ADHESION
Deposited on 2000-05-12, released 2000-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: intimin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f00i1, d1f00i2, d1f00i3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f00I (I:)
    asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy
    akvtltsttpgkslvsarvsdvavdvkapeveffttltiddgnieivgtgvkgklptvwl
    qygqvnlkasggngkytwrsanpaiasvdassgqvtlkekgtttisvissdnqtatytia
    tpnslivpnmskrvtyndavntcknfggklpssqnelenvfkawgaankyeyykssqtii
    swvqqtaqdaksgvastydlvkqnplnnikasesnayatcvk