![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families) ![]() |
![]() | Family b.1.14.1: Invasin/intimin cell-adhesion fragments [49374] (2 proteins) |
![]() | Protein Intimin [49375] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49376] (5 PDB entries) an enteropathogenic serotype |
![]() | Domain d1f00i1: 1f00 I:658-752 [22368] Other proteins in same PDB: d1f00i3 |
PDB Entry: 1f00 (more details), 1.9 Å
SCOPe Domain Sequences for d1f00i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} asiteikadkttavangqdaitytvkvmkgdkpvsnqevtftttlgklsnstektdtngy akvtltsttpgkslvsarvsdvavdvkapevefft
Timeline for d1f00i1: