| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Kluyveromyces lactis [TaxId:284590] [226650] (1 PDB entry) |
| Domain d4jaxa1: 4jax A:15-223 [223660] automated match to d1ig8a1 complexed with gol, po4 |
PDB Entry: 4jax (more details), 2.26 Å
SCOPe Domain Sequences for d4jaxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jaxa1 c.55.1.0 (A:15-223) automated matches {Kluyveromyces lactis [TaxId: 284590]}
smadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvveyp
tgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakcl
kefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqeq
ieklnipinvvalindttgtlvaslytdp
Timeline for d4jaxa1: