Lineage for d4jaxd2 (4jax D:224-485)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493099Species Kluyveromyces lactis [TaxId:284590] [226650] (1 PDB entry)
  8. 2493107Domain d4jaxd2: 4jax D:224-485 [223667]
    automated match to d1ig8a2
    complexed with gol, po4

Details for d4jaxd2

PDB Entry: 4jax (more details), 2.26 Å

PDB Description: crystal structure of dimeric klhxk1 in crystal form x
PDB Compounds: (D:) hexokinase

SCOPe Domain Sequences for d4jaxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaxd2 c.55.1.0 (D:224-485) automated matches {Kluyveromyces lactis [TaxId: 284590]}
qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk
ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt
sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic
dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga
aiiacltqkrlaagksvgikge

SCOPe Domain Coordinates for d4jaxd2:

Click to download the PDB-style file with coordinates for d4jaxd2.
(The format of our PDB-style files is described here.)

Timeline for d4jaxd2: