| Class b: All beta proteins [48724] (176 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
| Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries) Uniprot Q9HUM0 6-71 |
| Domain d4j6yb_: 4j6y B: [223611] automated match to d1u1sb_ complexed with cd |
PDB Entry: 4j6y (more details), 2.14 Å
SCOPe Domain Sequences for d4j6yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j6yb_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvrl
Timeline for d4j6yb_: