SCOPe 2.05: Domain d4j6yf_: 4j6y F:

Lineage for d4j6yf_ (4j6y F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
   forms homohexameric ring structures

6. Protein Pleiotropic translational regulator Hfq [74940] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries)
   Uniprot Q9HUM0 6-71

8. Domain d4j6yf_: 4j6y F: [223615]
   automated match to d1u1te_
   complexed with cd

Details for d4j6yf_

PDB Entry: 4j6y, 2.14 Å

PDB Description: Hfq from Pseudomonas aeruginosa crystallized in GTP presence

PDB Compounds: (F:) Protein hfq

SCOPe Domain Sequences for d4j6yf_:

Sequence; same for both SEQRES and ATOM records:

>d4j6yf_ b.38.1.2 (F:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
psrpvrl

Timeline for d4j6yf_:

• d4j6yf_ first appeared in SCOPe 2.03
  
• d4j6yf_ appears in SCOPe 2.04
  
• d4j6yf_ appears in SCOPe 2.06
  
• d4j6yf_ appears in the current release, SCOPe 2.08