SCOPe 2.05: Domain d4j6mg_: 4j6m G:

Lineage for d4j6mg_ (4j6m G:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
   Uniprot P06734 156-298

8. Domain d4j6mg_: 4j6m G: [223587]
   automated match to d1t8ca1
   complexed with so4

Details for d4j6mg_

PDB Entry: 4j6m, 2.48 Å

PDB Description: crystal structure of calcium2+-free wild-type cd23 lectin domain (crystal form d)

PDB Compounds: (G:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6mg_:

Sequence; same for both SEQRES and ATOM records:

>d4j6mg_ d.169.1.1 (G:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklga
wvcdrlatc

Timeline for d4j6mg_:

• d4j6mg_ first appeared in SCOPe 2.03
  
• d4j6mg_ appears in SCOPe 2.04
  
• d4j6mg_ appears in SCOPe 2.06
  
• d4j6mg_ appears in the current release, SCOPe 2.08