Lineage for d4j6mg_ (4j6m G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940668Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 1940669Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
    Uniprot P06734 156-298
  8. 1940701Domain d4j6mg_: 4j6m G: [223587]
    automated match to d1t8ca1
    complexed with so4

Details for d4j6mg_

PDB Entry: 4j6m (more details), 2.48 Å

PDB Description: crystal structure of calcium2+-free wild-type cd23 lectin domain (crystal form d)
PDB Compounds: (G:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j6mg_ d.169.1.1 (G:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklga
wvcdrlatc

SCOPe Domain Coordinates for d4j6mg_:

Click to download the PDB-style file with coordinates for d4j6mg_.
(The format of our PDB-style files is described here.)

Timeline for d4j6mg_: